PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 0500010178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB
Protein Properties Length: 653aa    MW: 71986.5 Da    PI: 7.2013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
0500010178genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.67.7e-15436481147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +  WT+eEde  ++ v+++G+g+W++ ar ++ g t+ q+ +rw+ +
       0500010178 436 KSTWTPEEDETVLCWVREHGTGNWTKLARLLP-GHTGQQILHRWRRL 481
                      578*****************************.***********976 PP

2Myb_DNA-binding43.95.5e-14488533245
                      SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 
                      g+WT+eEde l  av  + gg    W+++ ++++ +Rt+ qc++rw 
       0500010178 488 GAWTKEEDEALRVAVSAYSGGeriKWSLVQEHVP-TRTDVQCRERWT 533
                      68********************************.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0045279370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-15282298IPR009057Homeodomain-like
PROSITE profilePS500906.458282368IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.3E-15340381IPR009057Homeodomain-like
SuperFamilySSF466891.8E-13348412IPR009057Homeodomain-like
PROSITE profilePS500907.933369427IPR017877Myb-like domain
SMARTSM007176.4E-5373432IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-11382442IPR009057Homeodomain-like
SuperFamilySSF466897.31E-18417482IPR009057Homeodomain-like
PROSITE profilePS5129422.348431486IPR017930Myb domain
SMARTSM007171.2E-12435484IPR001005SANT/Myb domain
PfamPF002494.5E-14436481IPR001005SANT/Myb domain
CDDcd001671.58E-11438481No hitNo description
Gene3DG3DSA:1.10.10.602.3E-17443495IPR009057Homeodomain-like
SMARTSM007172.1E-13486538IPR001005SANT/Myb domain
PROSITE profilePS5129416.862488540IPR017930Myb domain
CDDcd001677.36E-10489536No hitNo description
PfamPF139218.2E-15490553No hitNo description
Gene3DG3DSA:1.10.10.602.7E-20496543IPR009057Homeodomain-like
SuperFamilySSF466892.54E-19516598IPR009057Homeodomain-like
PROSITE profilePS5129410.873541596IPR017930Myb domain
SMARTSM007176.4E-5541594IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-10544595IPR009057Homeodomain-like
CDDcd001672.92E-6544587No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MATTAEESED EALALAIGME LGERAHARGG ADDAGTSATV DADGRANDGV LRAMDRLGAR  60
MRTRRDEALI AGARALGREA SESEEEEEEE ESAGARALAT TTGAAAQGSR ALQILKTNPQ  120
VRNASQEHMF LPAIHKSLAP KIRTEMKTST FRPKLPTWAE TKKEHLAITG DLGAIGKALE  180
ANQNFQLDVR AMLESIDDXX XXXXXQGSSR ALVAAGVYVR HLGTEERALL PRAVGVDAVA  240
KNAKRAPLNL QKQITPNADQ LRLGWANLVD KIPLSYASHC RSWTPKEDEQ LRKGVHFQLQ  300
QARLLTDQRM SLEELAGISL QSLETLLVAG GLDVIARDAD AIQWEEVVRM HMPQRTVDDC  360
RLRWMNVVDP RICQTDWTDG EDERLVQLAE EMATNRDWTL IAQELHASNR TPGGLVRSPH  420
QCAVRYQAEW NPGLVKSTWT PEEDETVLCW VREHGTGNWT KLARLLPGHT GQQILHRWRR  480
LQPTRRIGAW TKEEDEALRV AVSAYSGGER IKWSLVQEHV PTRTDVQCRE RWTGVLDPSI  540
KTGAWTKEED TALMSALGWD FEEKGFNEWA RLSEVVPGRT GKNCMRRGKA LMKKKQKADA  600
AAVAAAAAAA TAEENGEAAP KKRRAAPKRS AAVAAEGTSP SAEPTTKRRV RS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-243465954158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-243465954158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003079275.10.0myb family transcription factor (ISS)
TrEMBLA0A090N3D60.0A0A090N3D6_
STRINGQ019J20.0(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP42351111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.23e-47myb domain protein 4r1